Lygodium japonicum Transcriptome Database
 

BLAST Search

  Sequence examples

>test
TTCAAGAGAAAAATTTGTGGGTGAGGGGTT AGGAAGAAACGATTTTGCCCAAAGGGGGTA TAATCTCGC

>test
MAAATAALSSSTLAGQVVLKPQSELAAKVG NVAGEARVTMRKTVSKVSDSPWYGPDRVKY LGPFSGEAPSYLTGEFPGDYGWDTAGLSAD


Option

Program: blastn tblastn tblastx blastp blastx
E-value: 0.1 0.01 0.001 1e-5 1e-10 1e-30
Filter: ON OFF